General Information

  • ID:  hor005721
  • Uniprot ID:  P14765
  • Protein name:  Neuropeptide Y
  • Gene name:  NPY
  • Organism:  Ovis aries (Sheep)
  • Family:  NPY family
  • Source:  animal
  • Expression:  One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008343 adult feeding behavior; GO:0032100 positive regulation of appetite
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  YPSKPDNPGDDAPAEDLARYYSALRHYINLITRQRY
  • Length:  36
  • Propeptide:  MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGDDAPAEDLARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTGNIPRTRLEDPSMW
  • Signal peptide:  MLGSKRLGLSGLTLALSLLVCLGALAEA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPY1R, NPY2R
  • Target Unid:  Q28602, P79211
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P14765-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005721_AF2.pdbhor005721_ESM.pdb

Physical Information

Mass: 486513 Formula: C189H284N54O58
Absent amino acids: CFMVW Common amino acids: Y
pI: 7.51 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -114.17 Boman Index: -10769
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 65.28
Instability Index: 5705.56 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  2599092
  • Title:  Sheep Neuropeptide Y. A Third Structural Type of a Highly Conserved Peptide